ACAA1 anticorps
-
- Antigène Voir toutes ACAA1 Anticorps
- ACAA1 (Acetyl-CoA Acyltransferase 1 (ACAA1))
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACAA1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ACAA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD
- Top Product
- Discover our top product ACAA1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ACAA1 Blocking Peptide, catalog no. 33R-1110, is also available for use as a blocking control in assays to test for specificity of this ACAA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACAA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ACAA1 (Acetyl-CoA Acyltransferase 1 (ACAA1))
- Autre désignation
- ACAA1 (ACAA1 Produits)
- Synonymes
- anticorps ACAA, anticorps PTHIO, anticorps THIO, anticorps Acaa, anticorps Acaa1, anticorps D9Ertd25e, anticorps PTL, anticorps zgc:92385, anticorps acaa, anticorps pthio, anticorps thio, anticorps A2MP, anticorps Pktaa, anticorps acetyl-CoA acyltransferase 1, anticorps acetyl-Coenzyme A acyltransferase 1A, anticorps acetyl-CoA acyltransferase 1 L homeolog, anticorps ACP synthase, anticorps alpha-2-macroglobulin pseudogene 1, anticorps acetyl-CoA acyltransferase 1A, anticorps ACAA1, anticorps Acaa1a, anticorps acaa1.L, anticorps acaa1, anticorps AF_RS00150, anticorps A2MP1, anticorps Acaa1
- Sujet
- ACAA1 is an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome.
- Poids moléculaire
- 44 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-