NAA30 anticorps (Middle Region)
-
- Antigène Voir toutes NAA30 Anticorps
- NAA30 (N(alpha)-Acetyltransferase 30, NatC Catalytic Subunit (NAA30))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NAA30 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NAT12 antibody was raised against the middle region of NAT12
- Purification
- Affinity purified
- Immunogène
- NAT12 antibody was raised using the middle region of NAT12 corresponding to a region with amino acids EQVRLLSSSLTADCSLRSPSGREVEPGEDRTIRYVRYESELQMPDIMRLI
- Top Product
- Discover our top product NAA30 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NAT12 Blocking Peptide, catalog no. 33R-2683, is also available for use as a blocking control in assays to test for specificity of this NAT12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAT12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NAA30 (N(alpha)-Acetyltransferase 30, NatC Catalytic Subunit (NAA30))
- Autre désignation
- NAT12 (NAA30 Produits)
- Synonymes
- anticorps C14orf35, anticorps MAK3, anticorps Mak3p, anticorps NAT12, anticorps 4930487N19Rik, anticorps 5730533P17Rik, anticorps AI447922, anticorps AW322455, anticorps Nat12, anticorps RGD1559923, anticorps mak3, anticorps mak3p, anticorps nat12, anticorps N(alpha)-acetyltransferase 30, NatC catalytic subunit, anticorps N(alpha)-acetyltransferase 30, NatC catalytic subunit S homeolog, anticorps NAA30, anticorps Naa30, anticorps naa30.S
- Sujet
- NAT12 belongs to the acetyltransferase family, MAK3 subfamily. It contains 1 N-acetyltransferase domain. It is a probable N-acetyltransferase.
- Poids moléculaire
- 39 kDa (MW of target protein)
-