RABGGTB anticorps (Middle Region)
-
- Antigène Voir toutes RABGGTB Anticorps
- RABGGTB (Rab Geranylgeranyltransferase, beta Subunit (RABGGTB))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RABGGTB est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RABGGTB antibody was raised against the middle region of RABGGTB
- Purification
- Affinity purified
- Immunogène
- RABGGTB antibody was raised using the middle region of RABGGTB corresponding to a region with amino acids PGDMVDPFHTLFGIAGLSLLGEEQIKPVNPVFCMPEEVLQRVNVQPELVS
- Top Product
- Discover our top product RABGGTB Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RABGGTB Blocking Peptide, catalog no. 33R-7095, is also available for use as a blocking control in assays to test for specificity of this RABGGTB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RABGGTB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RABGGTB (Rab Geranylgeranyltransferase, beta Subunit (RABGGTB))
- Autre désignation
- RABGGTB (RABGGTB Produits)
- Synonymes
- anticorps RABGGTB, anticorps wu:fj12b07, anticorps zgc:56443, anticorps GGTB, anticorps Rab geranylgeranyltransferase beta subunit, anticorps Rab geranylgeranyltransferase, beta subunit, anticorps Rab geranylgeranyl transferase, b subunit, anticorps Rab geranylgeranyltransferase, beta subunit S homeolog, anticorps RABGGTB, anticorps AFUA_7G04460, anticorps NFIA_025430, anticorps ACLA_006160, anticorps PMAA_088560, anticorps AFLA_073740, anticorps TSTA_124030, anticorps TRV_03221, anticorps rabggtb, anticorps Rabggtb, anticorps rabggtb.S
- Sujet
- RABGGTB catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to both cysteines in Rab proteins with an -XXCC, -XCXC and -CCXX C-terminal, such as RAB1A, RAB3A and RAB5A respectively.
- Poids moléculaire
- 37 kDa (MW of target protein)
-