TCP10 anticorps

N° du produit ABIN631533

Détail du produit anti-TCP10 anticorps

Antigène: TCP10 (T-Complex 10 (TCP10))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TCP10 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: TCP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids ERINSGKTPPQEDREKSPPGRRQDRSPAPTGRPTPGAERRGVSEDGKIMH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TCP10 Blocking Peptide, catalog no. 33R-2697, is also available for use as a blocking control in assays to test for specificity of this TCP10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCP10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TCP10

Antigène: TCP10 (T-Complex 10 (TCP10))

Autre désignation: TCP10 (TCP10 Produits)

Synonymes: anticorps TCP10A, anticorps t-complex 10, anticorps TCP10

Sujet: The function of TCP10 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 35 kDa (MW of target protein)