NSUN3 anticorps (C-Term)

N° du produit ABIN631537

Détail du produit anti-NSUN3 anticorps

Antigène: NSUN3 (NOP2/Sun Domain Family, Member 3 (NSUN3))

Épitope: C-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NSUN3 est non-conjugé

Application: Western Blotting (WB)

Specificité: NSUN3 antibody was raised against the C terminal of NSUN3

Purification: Affinity purified

Immunogène: NSUN3 antibody was raised using the C terminal of NSUN3 corresponding to a region with amino acids LPLLQIELLRSAIKALRPGGILVYSTCTLSKAENQDVISEILNSHGNIMP

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NSUN3 Blocking Peptide, catalog no. 33R-5271, is also available for use as a blocking control in assays to test for specificity of this NSUN3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSUN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NSUN3

Antigène: NSUN3 (NOP2/Sun Domain Family, Member 3 (NSUN3))

Autre désignation: NSUN3 (NSUN3 Produits)

Synonymes: anticorps 6720484A09Rik, anticorps AU022521, anticorps MST077, anticorps im:7142194, anticorps zgc:109983, anticorps NOL1/NOP2/Sun domain family member 3, anticorps NOP2/Sun RNA methyltransferase family member 3, anticorps NOP2/Sun domain family, member 3, anticorps Nsun3, anticorps NSUN3, anticorps nsun3

Sujet: NSUN3 may have S-adenosyl-L-methionine-dependent methyl-transferase activity.

Poids moléculaire: 38 kDa (MW of target protein)