TTC16 anticorps (C-Term)
-
- Antigène Tous les produits TTC16
- TTC16 (Tetratricopeptide Repeat Domain 16 (TTC16))
-
Épitope
- C-Term
- Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TTC16 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TTC16 antibody was raised against the C terminal of TTC16
- Purification
- Affinity purified
- Immunogène
- TTC16 antibody was raised using the C terminal of TTC16 corresponding to a region with amino acids RSRGLLRSSTKTEAFYDSNWSLSKTEYAQGQGQRSSKAEGAQGKSQGMSS
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TTC16 Blocking Peptide, catalog no. 33R-8209, is also available for use as a blocking control in assays to test for specificity of this TTC16 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC16 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TTC16 (Tetratricopeptide Repeat Domain 16 (TTC16))
- Autre désignation
- TTC16 (TTC16 Produits)
- Synonymes
- anticorps 1200002K10Rik, anticorps tetratricopeptide repeat domain 16, anticorps TTC16, anticorps Ttc16
- Sujet
- TTC16 contains 8 TPR repeats. The exact function of TTC16 remains unknown.
- Poids moléculaire
- 98 kDa (MW of target protein)
-