METTL6 anticorps (N-Term)

N° du produit ABIN631546

Détail du produit anti-METTL6 anticorps

Antigène: METTL6 (Methyltransferase Like 6 (METTL6))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp METTL6 est non-conjugé

Application: Western Blotting (WB)

Specificité: METTL6 antibody was raised against the N terminal of METTL6

Purification: Affinity purified

Immunogène: METTL6 antibody was raised using the N terminal of METTL6 corresponding to a region with amino acids QKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTML

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

METTL6 Blocking Peptide, catalog no. 33R-7606, is also available for use as a blocking control in assays to test for specificity of this METTL6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur METTL6

Antigène: METTL6 (Methyltransferase Like 6 (METTL6))

Autre désignation: METTL6 (METTL6 Produits)

Synonymes: anticorps zgc:56175, anticorps zgc:76943, anticorps 1600013P15Rik, anticorps AI467521, anticorps AU020711, anticorps methyltransferase like 6, anticorps methyltransferase like 6 L homeolog, anticorps mettl6, anticorps mettl6.L, anticorps METTL6, anticorps Mettl6

Sujet: METTL6 is a probable methyltransferase.

Poids moléculaire: 33 kDa (MW of target protein)