GSTa5 anticorps (Middle Region)
-
- Antigène Voir toutes GSTa5 Anticorps
- GSTa5 (Glutathione S-Transferase alpha 5 (GSTa5))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GSTa5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GSTA5 antibody was raised against the middle region of GSTA5
- Purification
- Affinity purified
- Immunogène
- GSTA5 antibody was raised using the middle region of GSTA5 corresponding to a region with amino acids QPEERDAKTALVKEKIKNRYFPAFEKVLKSHRQDYLVGNKLSWADIHLVE
- Top Product
- Discover our top product GSTa5 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GSTA5 Blocking Peptide, catalog no. 33R-7675, is also available for use as a blocking control in assays to test for specificity of this GSTA5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTA5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GSTa5 (Glutathione S-Transferase alpha 5 (GSTa5))
- Autre désignation
- GSTA5 (GSTa5 Produits)
- Synonymes
- anticorps Gsta2, anticorps Yc2, anticorps glutathione S-transferase alpha 5, anticorps glutathione S-transferase alpha 3, anticorps GSTA5, anticorps Gsta5, anticorps Gsta3
- Sujet
- GSTA5 belongs to the GST superfamily, alpha family. It contains 1 GST C-terminal domain and 1 GST N-terminal domain. The exact functions of GSTA5 remain unknown.
- Poids moléculaire
- 26 kDa (MW of target protein)
-