LOC652559 anticorps (Middle Region)

N° du produit ABIN631554

Détail du produit anti-LOC652559 anticorps

Antigène: LOC652559

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LOC652559 est non-conjugé

Application: Western Blotting (WB)

Specificité: LOC652559 antibody was raised against the middle region of Loc652559

Purification: Affinity purified

Immunogène: LOC652559 antibody was raised using the middle region of Loc652559 corresponding to a region with amino acids EKSKLGEVDHTLDLVVSFIQEQIVTEEAKSKNSGDAGVDRSLRGPYLARL

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LOC652559 Blocking Peptide, catalog no. 33R-2522, is also available for use as a blocking control in assays to test for specificity of this LOC652559 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC652559 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LOC652559

Antigène: LOC652559

Autre désignation: LOC652559 (LOC652559 Produits)

Sujet: The sequence of LOC652559 is derived from an annotated genomic sequence (NW_922352) using gene prediction method: GNOMON. The exact function of LOC652559 remains unknown.

Poids moléculaire: 32 kDa (MW of target protein)