SLC47A2 anticorps (C-Term)

N° du produit ABIN631558

Détail du produit anti-SLC47A2 anticorps

Antigène: SLC47A2 (Solute Carrier Family 47, Member 2 (SLC47A2))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC47A2 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLC47 A2 antibody was raised against the C terminal of SLC47 2

Purification: Affinity purified

Immunogène: SLC47 A2 antibody was raised using the C terminal of SLC47 2 corresponding to a region with amino acids TYSRSECHVDFFRTPEEAHALSAPTSRLSVKQLVIRRGAALGAASATLMV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC47A2 Blocking Peptide, catalog no. 33R-9403, is also available for use as a blocking control in assays to test for specificity of this SLC47A2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC47A2

Antigène: SLC47A2 (Solute Carrier Family 47, Member 2 (SLC47A2))

Autre désignation: SLC47A2 (SLC47A2 Produits)

Synonymes: anticorps RGD1562382, anticorps MATE2, anticorps DKFZp469G161, anticorps SLC47A2, anticorps MATE2-B, anticorps MATE2-K, anticorps MATE2K, anticorps 4933429E10Rik, anticorps solute carrier family 47 member 1, anticorps solute carrier family 47 member 2, anticorps multidrug and toxin extrusion protein 2, anticorps solute carrier family 47, member 2, anticorps SLC47A1, anticorps Slc47a2, anticorps SLC47A2, anticorps MGYG_04899, anticorps LOC100020163, anticorps LOC100073163

Sujet: SLC47A2 is a protein belonging to a family of transporters involved in excretion of toxic electrolytes, both endogenous and exogenous, through urine and bile. This transporter family shares homology with the bacterial MATE (multidrug and toxin extrusion) protein family responsible for drug resistance.

Poids moléculaire: 61 kDa (MW of target protein)