TIGD4 anticorps (N-Term)

N° du produit ABIN631561

Détail du produit anti-TIGD4 anticorps

Antigène: TIGD4 (Tigger Transposable Element Derived 4 (TIGD4))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TIGD4 est non-conjugé

Application: Western Blotting (WB)

Specificité: TIGD4 antibody was raised against the N terminal of TIGD4

Purification: Affinity purified

Immunogène: TIGD4 antibody was raised using the N terminal of TIGD4 corresponding to a region with amino acids RFDPKRKRLRTAFYTDLEEALMRWYRIAQCLNVPVNGPMLRLKANDFAQK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TIGD4 Blocking Peptide, catalog no. 33R-7898, is also available for use as a blocking control in assays to test for specificity of this TIGD4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIGD4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TIGD4

Antigène: TIGD4 (Tigger Transposable Element Derived 4 (TIGD4))

Autre désignation: TIGD4 (TIGD4 Produits)

Synonymes: anticorps C130063O11Rik, anticorps Gm418, anticorps tigger transposable element derived 4, anticorps PGTG_00971, anticorps Tigd4, anticorps TIGD4

Sujet: The protein encoded by this gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of this gene is not known.

Poids moléculaire: 57 kDa (MW of target protein)