KLHDC1 anticorps (N-Term)

N° du produit ABIN631564

Détail du produit anti-KLHDC1 anticorps

Antigène: KLHDC1 (Kelch Domain Containing 1 (KLHDC1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KLHDC1 est non-conjugé

Application: Western Blotting (WB)

Specificité: KLHDC1 antibody was raised against the N terminal of KLHDC1

Purification: Affinity purified

Immunogène: KLHDC1 antibody was raised using the N terminal of KLHDC1 corresponding to a region with amino acids IDSGLWRMHLMEGELPASMSGSCGACINGKLYIFGGYDDKGYSNRLYFVN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KLHDC1 Blocking Peptide, catalog no. 33R-3929, is also available for use as a blocking control in assays to test for specificity of this KLHDC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KLHDC1

Antigène: KLHDC1 (Kelch Domain Containing 1 (KLHDC1))

Autre désignation: KLHDC1 (KLHDC1 Produits)

Synonymes: anticorps MST025, anticorps kelch domain containing 1, anticorps KLHDC1, anticorps Klhdc1

Sujet: KLHDC1 contains 6 Kelch repeats. KLHDC1 and KLHDC2 have differential localization and activity in cultured mammalian cells. The exact function of KLHDC1 remains unknown.

Poids moléculaire: 47 kDa (MW of target protein)