PDLIM3 anticorps (N-Term)
-
- Antigène Voir toutes PDLIM3 Anticorps
- PDLIM3 (PDZ and LIM Domain 3 (PDLIM3))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PDLIM3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PDLIM3 antibody was raised against the N terminal of PDLIM3
- Purification
- Affinity purified
- Immunogène
- PDLIM3 antibody was raised using the N terminal of PDLIM3 corresponding to a region with amino acids PQTVILPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGDVILA
- Top Product
- Discover our top product PDLIM3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PDLIM3 Blocking Peptide, catalog no. 33R-7314, is also available for use as a blocking control in assays to test for specificity of this PDLIM3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDLIM3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PDLIM3 (PDZ and LIM Domain 3 (PDLIM3))
- Autre désignation
- PDLIM3 (PDLIM3 Produits)
- Sujet
- PDLIM3 contains a PDZ domain and a LIM domain, indicating that it may be involved in cytoskeletal assembly. In support of this, PDLIM3 has been shown to bind the spectrin-like repeats of alpha-actinin-2 and to colocalize with alpha-actinin-2 at the Z lines of skeletal muscle.
- Poids moléculaire
- 39 kDa (MW of target protein)
-