PDLIM3 anticorps (N-Term)

N° du produit ABIN631568

Détail du produit anti-PDLIM3 anticorps

Antigène: PDLIM3 (PDZ and LIM Domain 3 (PDLIM3))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDLIM3 est non-conjugé

Application: Western Blotting (WB)

Specificité: PDLIM3 antibody was raised against the N terminal of PDLIM3

Purification: Affinity purified

Immunogène: PDLIM3 antibody was raised using the N terminal of PDLIM3 corresponding to a region with amino acids PQTVILPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGDVILA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDLIM3 Blocking Peptide, catalog no. 33R-7314, is also available for use as a blocking control in assays to test for specificity of this PDLIM3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDLIM3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDLIM3

Antigène: PDLIM3 (PDZ and LIM Domain 3 (PDLIM3))

Autre désignation: PDLIM3 (PDLIM3 Produits)

Synonymes: anticorps LIM, anticorps Actn2lp, anticorps Alp, anticorps AI463105, anticorps ALP, anticorps alp, anticorps hm:zeh1190, anticorps pdlim3, anticorps sb:eu571, anticorps zgc:110415, anticorps PDZ and LIM domain 3, anticorps PDZ and LIM domain 3 S homeolog, anticorps PDZ and LIM domain 3b, anticorps PDZ and LIM domain 3a, anticorps PDLIM3, anticorps Pdlim3, anticorps pdlim3.S, anticorps pdlim3b, anticorps pdlim3a

Sujet: PDLIM3 contains a PDZ domain and a LIM domain, indicating that it may be involved in cytoskeletal assembly. In support of this, PDLIM3 has been shown to bind the spectrin-like repeats of alpha-actinin-2 and to colocalize with alpha-actinin-2 at the Z lines of skeletal muscle.

Poids moléculaire: 39 kDa (MW of target protein)