DPCD anticorps (N-Term)

N° du produit ABIN631571

Détail du produit anti-DPCD anticorps

Antigène: DPCD (Deleted in Primary Ciliary Dyskinesia Homolog (DPCD))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DPCD est non-conjugé

Application: Western Blotting (WB)

Specificité: RP11-529 I10.4 antibody was raised against the N terminal of RP11-529 10.4

Purification: Affinity purified

Immunogène: RP11-529 I10.4 antibody was raised using the N terminal of RP11-529 10.4 corresponding to a region with amino acids MAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGDPAPLGAGNLGPELIK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RP11-529I10.4 Blocking Peptide, catalog no. 33R-5635, is also available for use as a blocking control in assays to test for specificity of this RP11-529I10.4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RP11-520 10.4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DPCD

Antigène: DPCD (Deleted in Primary Ciliary Dyskinesia Homolog (DPCD))

Autre désignation: RP11-529I10.4 (DPCD Produits)

Synonymes: anticorps RP11-529I10.4, anticorps zgc:153412, anticorps rp11-529i10.4, anticorps 5330431N19Rik, anticorps Ndac, anticorps RGD1307648, anticorps deleted in primary ciliary dyskinesia homolog (mouse), anticorps deleted in a mouse model of primary ciliary dyskinesia S homeolog, anticorps deleted in primary ciliary dyskinesia, anticorps DPCD, anticorps dpcd, anticorps dpcd.S, anticorps Dpcd

Sujet: RP11-529I10.4 (DPCD) belongs to the DPCD family. It may play a role in the formation or function of ciliated cells. Deletion of the DPCD gene may be a cause of primary ciliary dyskinesia (PCD).

Poids moléculaire: 23 kDa (MW of target protein)