DPCD anticorps (N-Term)
-
- Antigène Voir toutes DPCD Anticorps
- DPCD (Deleted in Primary Ciliary Dyskinesia Homolog (DPCD))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DPCD est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RP11-529 I10.4 antibody was raised against the N terminal of RP11-529 10.4
- Purification
- Affinity purified
- Immunogène
- RP11-529 I10.4 antibody was raised using the N terminal of RP11-529 10.4 corresponding to a region with amino acids MAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGDPAPLGAGNLGPELIK
- Top Product
- Discover our top product DPCD Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RP11-529I10.4 Blocking Peptide, catalog no. 33R-5635, is also available for use as a blocking control in assays to test for specificity of this RP11-529I10.4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RP11-520 10.4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DPCD (Deleted in Primary Ciliary Dyskinesia Homolog (DPCD))
- Autre désignation
- RP11-529I10.4 (DPCD Produits)
- Synonymes
- anticorps RP11-529I10.4, anticorps zgc:153412, anticorps rp11-529i10.4, anticorps 5330431N19Rik, anticorps Ndac, anticorps RGD1307648, anticorps deleted in primary ciliary dyskinesia homolog (mouse), anticorps deleted in a mouse model of primary ciliary dyskinesia S homeolog, anticorps deleted in primary ciliary dyskinesia, anticorps DPCD, anticorps dpcd, anticorps dpcd.S, anticorps Dpcd
- Sujet
- RP11-529I10.4 (DPCD) belongs to the DPCD family. It may play a role in the formation or function of ciliated cells. Deletion of the DPCD gene may be a cause of primary ciliary dyskinesia (PCD).
- Poids moléculaire
- 23 kDa (MW of target protein)
-