NCAPH2 anticorps (N-Term)

N° du produit ABIN631576

Détail du produit anti-NCAPH2 anticorps

Antigène: NCAPH2 (Non-SMC Condensin II Complex, Subunit H2 (NCAPH2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NCAPH2 est non-conjugé

Application: Western Blotting (WB)

Specificité: NCAPH2 antibody was raised against the N terminal of NCAPH2

Purification: Affinity purified

Immunogène: NCAPH2 antibody was raised using the N terminal of NCAPH2 corresponding to a region with amino acids EYLYSLVYQALDFISGKRRAKQLSSVQEDRANGVASSGVPQEAENEFLSL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NCAPH2 Blocking Peptide, catalog no. 33R-2826, is also available for use as a blocking control in assays to test for specificity of this NCAPH2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCAPH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NCAPH2

Antigène: NCAPH2 (Non-SMC Condensin II Complex, Subunit H2 (NCAPH2))

Autre désignation: NCAPH2 (NCAPH2 Produits)

Synonymes: anticorps MGC81656, anticorps CAPH2, anticorps si:dkey-202b22.2, anticorps non-SMC condensin II complex subunit H2, anticorps non-SMC condensin II complex subunit H2 L homeolog, anticorps non-SMC condensin II complex, subunit H2, anticorps NCAPH2, anticorps ncaph2.L, anticorps ncaph2, anticorps Ncaph2

Sujet: Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 and SMC4, but they contain different sets of non-SMC subunits. NCAPH2 is 1 of 3 non-SMC subunits that define condensin II.

Poids moléculaire: 68 kDa (MW of target protein)