RPL37A anticorps (Middle Region)
-
- Antigène Voir toutes RPL37A Anticorps
- RPL37A (Ribosomal Protein L37a (RPL37A))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RPL37A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RPL37 A antibody was raised against the middle region of RPL37
- Purification
- Affinity purified
- Immunogène
- RPL37 A antibody was raised using the middle region of RPL37 corresponding to a region with amino acids CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD
- Top Product
- Discover our top product RPL37A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RPL37A Blocking Peptide, catalog no. 33R-1703, is also available for use as a blocking control in assays to test for specificity of this RPL37A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL30 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RPL37A (Ribosomal Protein L37a (RPL37A))
- Autre désignation
- RPL37A (RPL37A Produits)
- Synonymes
- anticorps L37A, anticorps BcDNA:RE23595, anticorps BcDNA:RH41593, anticorps CG5827, anticorps DmL37a, anticorps Dmel\\CG5827, anticorps M(2)25C, anticorps M(2)S1, anticorps RpL37a, anticorps l(2)25Cb, anticorps CG9091, anticorps Dmel\\CG9091, anticorps RpL37, anticorps RpL37A, anticorps RGD1561181, anticorps Rpl37a, anticorps ribosomal protein L37a, anticorps Ribosomal protein L37A, anticorps ribosomal protein L37a L homeolog, anticorps Ribosomal protein L37a, anticorps ribosomal protein L37a, pseudogene 1, anticorps RPL37A, anticorps Rpl37a, anticorps RpL37A, anticorps rpl37a.L, anticorps RpL37a, anticorps Rpl37a-ps1
- Sujet
- Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.
- Poids moléculaire
- 10 kDa (MW of target protein)
-