RPS13 anticorps (N-Term)

N° du produit ABIN631578

Détail du produit anti-RPS13 anticorps

Antigène: RPS13 (Ribosomal Protein S13 (RPS13))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPS13 est non-conjugé

Application: Western Blotting (WB)

Specificité: RPS13 antibody was raised against the N terminal of RPS13

Purification: Affinity purified

Immunogène: RPS13 antibody was raised using the N terminal of RPS13 corresponding to a region with amino acids MGRMHAPGKGLSQSALPYRRSVPTWLKLTSDDVKEQIYKLAKKGLTPSQI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPS13 Blocking Peptide, catalog no. 33R-6067, is also available for use as a blocking control in assays to test for specificity of this RPS13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPS13

Antigène: RPS13 (Ribosomal Protein S13 (RPS13))

Autre désignation: RPS13 (RPS13 Produits)

Synonymes: anticorps S13, anticorps 2700063M04Rik, anticorps fb14f11, anticorps fd13f08, anticorps fd60g01, anticorps wu:fb14f11, anticorps wu:fd13f08, anticorps wu:fd60g01, anticorps zgc:91809, anticorps rps13, anticorps ribosomal protein S13, anticorps ribosomal protein13, anticorps 40S ribosomal protein S13, anticorps 30S ribosomal protein S13, anticorps ribosomal protein S13 L homeolog, anticorps Rps13, anticorps RPS13, anticorps rps13, anticorps rps-13, anticorps rps13.L

Sujet: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Poids moléculaire: 17 kDa (MW of target protein)