RPS15 anticorps (Middle Region)
-
- Antigène Voir toutes RPS15 Anticorps
- RPS15 (Ribosomal Protein S15 (RPS15))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat, C. elegans
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RPS15 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RPS15 antibody was raised against the middle region of RPS15
- Purification
- Affinity purified
- Immunogène
- RPS15 antibody was raised using the middle region of RPS15 corresponding to a region with amino acids GVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPL
- Top Product
- Discover our top product RPS15 Anticorps primaire
-
anti-Ribosomal Protein S15 (RPS15) antibody
RPS15 Reactivité: Humain WB, IF, IHC (p), ICC, IHC (wm) Hôte: Lapin Polyclonal unconjugated
anti-Ribosomal Protein S15 (RPS15) (AA 63-137) antibodyRPS15 Reactivité: Humain WB, ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Ribosomal Protein S15 (RPS15) (AA 1-30), (N-Term) antibodyRPS15 Reactivité: Humain WB, FACS, IHC (p) Hôte: Lapin Polyclonal RB21257 unconjugated
anti-Ribosomal Protein S15 (RPS15) (AA 77-145) antibodyRPS15 Reactivité: Humain WB, ELISA Hôte: Souris Monoclonal 4H8 unconjugated
anti-Ribosomal Protein S15 (RPS15) (C-Term) antibodyRPS15 Reactivité: Humain, Souris, Rat WB, ELISA, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-Ribosomal Protein S15 (RPS15) antibodyRPS15 Reactivité: Humain WB, IHC, FACS Hôte: Lapin Polyclonal unconjugated
anti-Ribosomal Protein S15 (RPS15) (AA 1-145) antibodyRPS15 Reactivité: Humain ELISA Hôte: Souris Monoclonal 3F8 unconjugated
anti-Ribosomal Protein S15 (RPS15) (C-Term) antibodyRPS15 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cobaye, Lapin, Poisson zèbre (Danio rerio), Poulet, Drosophila melanogaster, Hamster, Insectes, Singe, Porc, Xenopus laevis WB Hôte: Lapin Polyclonal unconjugated
anti-Ribosomal Protein S15 (RPS15) (Middle Region) antibodyRPS15 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cobaye, Lapin, Poisson zèbre (Danio rerio) WB Hôte: Lapin Polyclonal unconjugated
anti-Ribosomal Protein S15 (RPS15) (N-Term) antibodyRPS15 Reactivité: Humain WB, EIA Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RPS15 Blocking Peptide, catalog no. 33R-3662, is also available for use as a blocking control in assays to test for specificity of this RPS15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS15 antibody in PBS
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RPS15 (Ribosomal Protein S15 (RPS15))
- Autre désignation
- RPS15 (RPS15 Produits)
- Synonymes
- anticorps RIG, anticorps S15, anticorps rig, anticorps wu:fa93f04, anticorps wu:fa99b07, anticorps zgc:103714, anticorps zgc:92743, anticorps ribosomal protein S15, anticorps 40S ribosomal protein S15, anticorps RPS15, anticorps Rps15, anticorps rps15, anticorps rps-15
- Sujet
- Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.
- Poids moléculaire
- 17 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-
