GOPC anticorps (N-Term)

N° du produit ABIN631580

Détail du produit anti-GOPC anticorps

Antigène: GOPC (Golgi-Associated PDZ and Coiled-Coil Motif Containing (GOPC))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GOPC est non-conjugé

Application: Western Blotting (WB)

Specificité: GOPC antibody was raised against the N terminal of GOPC

Purification: Affinity purified

Immunogène: GOPC antibody was raised using the N terminal of GOPC corresponding to a region with amino acids EVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GOPC Blocking Peptide, catalog no. 33R-2799, is also available for use as a blocking control in assays to test for specificity of this GOPC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOPC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GOPC

Antigène: GOPC (Golgi-Associated PDZ and Coiled-Coil Motif Containing (GOPC))

Autre désignation: GOPC (GOPC Produits)

Synonymes: anticorps DKFZp459H2130, anticorps 2210402P09Rik, anticorps AI844555, anticorps CAL, anticorps FIG, anticorps GOPC1, anticorps PIST, anticorps fe38f01, anticorps wu:fe38f01, anticorps zgc:56254, anticorps zgc:65853, anticorps dJ94G16.2, anticorps cal, anticorps gopc1, anticorps pist, anticorps golgi associated PDZ and coiled-coil motif containing, anticorps golgi-associated PDZ and coiled-coil motif containing, anticorps golgi-associated PDZ and coiled-coil motif containing S homeolog, anticorps GOPC, anticorps Gopc, anticorps gopc, anticorps gopc.S

Sujet: GOPC plays a role in intracellular protein trafficking and degradation. GOPC may regulate CFTR chloride currents and acid-induced ACCN3 currents by modulating cell surface expression of both channels. GOPC may also regulate the intracellular trafficking of the ADR1B receptor. GOPC may play a role in autophagy.

Poids moléculaire: 50 kDa (MW of target protein)

Pathways: Maintenance of Protein Location, Asymmetric Protein Localization