RPS15A anticorps (Middle Region)

N° du produit ABIN631582

Détail du produit anti-RPS15A anticorps

Antigène: RPS15A (RA) (Ribosomal Protein S15a (RA))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPS15A est non-conjugé

Application: Western Blotting (WB)

Specificité: RPS15 A antibody was raised against the middle region of RPS15

Purification: Affinity purified

Immunogène: RPS15 A antibody was raised using the middle region of RPS15 corresponding to a region with amino acids KCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPS15A Blocking Peptide, catalog no. 33R-4269, is also available for use as a blocking control in assays to test for specificity of this RPS15A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPS15A

Antigène: RPS15A (RA) (Ribosomal Protein S15a (RA))

Autre désignation: RPS15A (RA Produits)

Synonymes: anticorps S15a, anticorps A630031B11Rik, anticorps wu:fb04b07, anticorps ribosomal protein S15a, anticorps ribosomal protein S15A, anticorps ribosomal protein S15a S homeolog, anticorps 40S ribosomal protein S15a, anticorps Rps15a, anticorps RPS15A, anticorps rps15a, anticorps rps15a.S, anticorps LOC619131

Sujet: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit.

Poids moléculaire: 15 kDa (MW of target protein)