FAIM anticorps (N-Term)

N° du produit ABIN631583

Détail du produit anti-FAIM anticorps

Antigène: FAIM (Fas Apoptotic Inhibitory Molecule (FAIM))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAIM est non-conjugé

Application: Western Blotting (WB)

Specificité: FAIM antibody was raised against the N terminal of FAIM

Purification: Affinity purified

Immunogène: FAIM antibody was raised using the N terminal of FAIM corresponding to a region with amino acids MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAIM Blocking Peptide, catalog no. 33R-6537, is also available for use as a blocking control in assays to test for specificity of this FAIM antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAIM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAIM

Antigène: FAIM (Fas Apoptotic Inhibitory Molecule (FAIM))

Autre désignation: FAIM (FAIM Produits)

Synonymes: anticorps FAIM1, anticorps FAIM, anticorps faim, anticorps zgc:92712, anticorps zgc:92723, anticorps Fas apoptotic inhibitory molecule, anticorps Fas apoptotic inhibitory molecule L homeolog, anticorps Fas apoptotic inhibitory molecule b, anticorps Fas apoptotic inhibitory molecule a, anticorps FAIM, anticorps Faim, anticorps faim, anticorps faim.L, anticorps Tsp_00038, anticorps faimb, anticorps faima

Sujet: FAIM plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells.

Poids moléculaire: 24 kDa (MW of target protein)