CENPQ anticorps (N-Term)
-
- Antigène Voir toutes CENPQ Anticorps
- CENPQ (Centromere Protein Q (CENPQ))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CENPQ est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CENPQ antibody was raised against the N terminal of CENPQ
- Purification
- Affinity purified
- Immunogène
- CENPQ antibody was raised using the N terminal of CENPQ corresponding to a region with amino acids VRNTVKKNKNHLKDLSSEGQTKHTNLKHGKTAASKRKTWQPLSKSTRDHL
- Top Product
- Discover our top product CENPQ Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CENPQ Blocking Peptide, catalog no. 33R-9780, is also available for use as a blocking control in assays to test for specificity of this CENPQ antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENPQ antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CENPQ (Centromere Protein Q (CENPQ))
- Autre désignation
- CENPQ (CENPQ Produits)
- Synonymes
- anticorps C6orf139, anticorps CENP-Q, anticorps 2610528M18Rik, anticorps centromere protein Q, anticorps CENPQ, anticorps cenpq, anticorps Cenpq
- Sujet
- CENPQ is a subunit of a CENPH-CENPI-associated centromeric complex that targets CENPA to centromeres and is required for proper kinetochore function and mitotic progression.
- Poids moléculaire
- 30 kDa (MW of target protein)
-