SCYL3 anticorps

N° du produit ABIN631591

Détail du produit anti-SCYL3 anticorps

Antigène: SCYL3 (SCY1-Like 3 (SCYL3))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SCYL3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SCYL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGSENSALKSYTLREPPFTLPSGLAVYPAVLQDGKFASVFVYKRENEDKV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SCYL3 Blocking Peptide, catalog no. 33R-6074, is also available for use as a blocking control in assays to test for specificity of this SCYL3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCYL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SCYL3

Antigène: SCYL3 (SCY1-Like 3 (SCYL3))

Autre désignation: SCYL3 (SCYL3 Produits)

Synonymes: anticorps RGD1308992, anticorps zgc:55575, anticorps wu:fc11d06, anticorps wu:faa95c04, anticorps 1200016D23RIK, anticorps pace1, anticorps pace-1, anticorps MGC81481, anticorps rp1-97p20.2, anticorps PACE-1, anticorps PACE1, anticorps 1200016D23Rik, anticorps 6030457O16, anticorps AW214499, anticorps Pace1, anticorps SCY1 like pseudokinase 3, anticorps SCY1-like, kinase-like 3, anticorps SCY1 like pseudokinase 3 L homeolog, anticorps SCY1-like 3 (S. cerevisiae), anticorps Scyl3, anticorps scyl3, anticorps SCYL3, anticorps scyl3.L

Sujet: SCYL3 may play a role in regulating cell adhesion/migration complexes in migrating cells.

Poids moléculaire: 83 kDa (MW of target protein)