ARHGAP25 anticorps (Middle Region)
-
- Antigène Voir toutes ARHGAP25 Anticorps
- ARHGAP25 (rho GTPase Activating Protein 25 (ARHGAP25))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ARHGAP25 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ARHGAP25 antibody was raised against the middle region of ARHGAP25
- Purification
- Affinity purified
- Immunogène
- ARHGAP25 antibody was raised using the middle region of ARHGAP25 corresponding to a region with amino acids SPGEEASALSSQACDSKGDTLASPNSETGPGKKNSGEEEIDSLQRMVQEL
- Top Product
- Discover our top product ARHGAP25 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ARHGAP25 Blocking Peptide, catalog no. 33R-8674, is also available for use as a blocking control in assays to test for specificity of this ARHGAP25 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGAP25 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ARHGAP25 (rho GTPase Activating Protein 25 (ARHGAP25))
- Autre désignation
- ARHGAP25 (ARHGAP25 Produits)
- Synonymes
- anticorps arhgap24, anticorps DKFZp468H165, anticorps KAIA0053, anticorps A130039I20Rik, anticorps RGD1562105, anticorps Rho GTPase activating protein 25, anticorps ARHGAP25, anticorps arhgap25, anticorps Arhgap25
- Sujet
- ARHGAPs, such as ARHGAP25, encode negative regulators of Rho GTPases, which are implicated in actin remodeling, cell polarity, and cell migration.
- Poids moléculaire
- 70 kDa (MW of target protein)
-