alpha KGDHC anticorps (N-Term)
-
- Antigène Voir toutes alpha KGDHC (alphaKGDHC) Anticorps
- alpha KGDHC (alphaKGDHC) (alpha Ketoglutarate Dehydrogenase (alphaKGDHC))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp alpha KGDHC est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- OGDH antibody was raised against the N terminal of OGDH
- Purification
- Affinity purified
- Immunogène
- OGDH antibody was raised using the N terminal of OGDH corresponding to a region with amino acids MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFL
- Top Product
- Discover our top product alphaKGDHC Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
OGDH Blocking Peptide, catalog no. 33R-5994, is also available for use as a blocking control in assays to test for specificity of this OGDH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OGDH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- alpha KGDHC (alphaKGDHC) (alpha Ketoglutarate Dehydrogenase (alphaKGDHC))
- Autre désignation
- OGDH (alphaKGDHC Produits)
- Sujet
- The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO2. It contains multiple copies of three enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3).
- Poids moléculaire
- 47 kDa (MW of target protein)
-