DHDDS anticorps (N-Term)

N° du produit ABIN631604

Détail du produit anti-DHDDS anticorps

Antigène: DHDDS (Dehydrodolichyl Diphosphate Synthase (DHDDS))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DHDDS est non-conjugé

Application: Western Blotting (WB)

Specificité: DHDDS antibody was raised against the N terminal of DHDDS

Purification: Affinity purified

Immunogène: DHDDS antibody was raised using the N terminal of DHDDS corresponding to a region with amino acids NRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DHDDS Blocking Peptide, catalog no. 33R-6864, is also available for use as a blocking control in assays to test for specificity of this DHDDS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHDDS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DHDDS

Antigène: DHDDS (Dehydrodolichyl Diphosphate Synthase (DHDDS))

Autre désignation: DHDDS (DHDDS Produits)

Synonymes: anticorps wu:fd56c06, anticorps zgc:77088, anticorps CIT, anticorps CPT, anticorps DS, anticorps HDS, anticorps RP59, anticorps 3222401G21Rik, anticorps W91638, anticorps dehydrodolichyl diphosphate synthase subunit, anticorps dehydrodolichyl diphosphate synthase, anticorps dehydrodolichyl diphosphate synthase subunit L homeolog, anticorps DHDDS, anticorps Dhdds, anticorps dhdds, anticorps dhdds.L

Sujet: Dehydrodolichyl diphosphate (dedol-PP) synthase catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier lipid required for the biosynthesis of several classes of glycoproteins.

Poids moléculaire: 39 kDa (MW of target protein)