GMPPA anticorps (N-Term)

N° du produit ABIN631606

Détail du produit anti-GMPPA anticorps

Antigène: GMPPA (GDP-Mannose Pyrophosphorylase A (GMPPA))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GMPPA est non-conjugé

Application: Western Blotting (WB)

Specificité: GMPPA antibody was raised against the N terminal of GMPPA

Purification: Affinity purified

Immunogène: GMPPA antibody was raised using the N terminal of GMPPA corresponding to a region with amino acids LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GMPPA Blocking Peptide, catalog no. 33R-5075, is also available for use as a blocking control in assays to test for specificity of this GMPPA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GMPPA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GMPPA

Antigène: GMPPA (GDP-Mannose Pyrophosphorylase A (GMPPA))

Autre désignation: GMPPA (GMPPA Produits)

Synonymes: anticorps gmppa, anticorps zgc:66135, anticorps gmppaa, anticorps gmppab, anticorps Afu6g07620, anticorps 1810012N01Rik, anticorps GMPP-alpha, anticorps zgc:91853, anticorps GDP-mannose pyrophosphorylase A, anticorps GDP-mannose pyrophosphorylase Ab, anticorps GDP-mannose pyrophosphorylase A S homeolog, anticorps GDP-mannose pyrophosphorylase A L homeolog, anticorps GDP-mannose pyrophosphorylase Aa, anticorps GMPPA, anticorps gmppab, anticorps gmppa.S, anticorps gmppa.L, anticorps AFUA_6G07620, anticorps NFIA_053290, anticorps ACLA_081780, anticorps PMAA_032270, anticorps AFLA_036250, anticorps TSTA_065350, anticorps BDBG_03451, anticorps Gmppa, anticorps gmppaa

Sujet: GMPPA is a GDP-mannose pyrophosphorylase. This enzyme catalyzes the reaction which converts mannose-1-phosphate and GTP to GDP-mannose which is involved in the production of N-linked oligosaccharides.

Poids moléculaire: 46 kDa (MW of target protein)