NRD1 anticorps
-
- Antigène Voir toutes NRD1 Anticorps
- NRD1 (Nardilysin (N-Arginine Dibasic Convertase) (NRD1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NRD1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- NRD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSKMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTSPLLADCI
- Top Product
- Discover our top product NRD1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NRD1 Blocking Peptide, catalog no. 33R-3570, is also available for use as a blocking control in assays to test for specificity of this NRD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NRD1 (Nardilysin (N-Arginine Dibasic Convertase) (NRD1))
- Autre désignation
- NRD1 (NRD1 Produits)
- Synonymes
- anticorps hNRD1, anticorps hNRD2, anticorps NRDC, anticorps 2600011I06Rik, anticorps AI875733, anticorps NRD-C, anticorps NRD1, anticorps si:dkey-171o17.4, anticorps DKFZp459N143, anticorps nardilysin convertase, anticorps nardilysin, N-arginine dibasic convertase, NRD convertase 1, anticorps nardilysin, anticorps nardilysin b (N-arginine dibasic convertase), anticorps NRDC, anticorps Nrdc, anticorps Nrd1, anticorps LOC552055, anticorps nrd1b, anticorps CpipJ_CPIJ002524, anticorps Tsp_03755
- Sujet
- NRD1 cleaves peptide substrates on the N-terminus of arginine residues in dibasic pairs.
- Poids moléculaire
- 132 kDa (MW of target protein)
- Pathways
- Skeletal Muscle Fiber Development
-