Keratin 75 anticorps (Middle Region)
-
- Antigène Voir toutes Keratin 75 (KRT75) Anticorps
- Keratin 75 (KRT75)
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Keratin 75 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Cytokeratin 75 antibody was raised against the middle region of KRT75
- Purification
- Affinity purified
- Immunogène
- Cytokeratin 75 antibody was raised using the middle region of KRT75 corresponding to a region with amino acids SFTTSGGHSLGAGLGGSGFSATSNRGLGGSGSSVKFVSTTSSSQKSYTH
- Top Product
- Discover our top product KRT75 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Cytokeratin 75 Blocking Peptide, catalog no. 33R-8442, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 75 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT75 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Keratin 75 (KRT75)
- Autre désignation
- Cytokeratin 75 (KRT75 Produits)
- Synonymes
- anticorps KRT75, anticorps K6HF, anticorps KB18, anticorps PFB, anticorps 4732468K03Rik, anticorps AA589387, anticorps K6hf, anticorps Krt2-6hf, anticorps Krtcap1, anticorps Kb18, anticorps keratin 75, anticorps keratin, type II cytoskeletal 75, anticorps keratin, type II cytoskeletal 6A, anticorps KRT75, anticorps LOC466991, anticorps LOC100566287, anticorps Krt75
- Sujet
- This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells.
- Poids moléculaire
- 59 kDa (MW of target protein)
-