PPP4C anticorps

N° du produit ABIN631624

Détail du produit anti-PPP4C anticorps

Antigène: PPP4C (Protein Phosphatase 4, Catalytic Subunit (PPP4C))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPP4C est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PPP4 C antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPP4C Blocking Peptide, catalog no. 33R-9365, is also available for use as a blocking control in assays to test for specificity of this PPP4C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPP4C

Antigène: PPP4C (Protein Phosphatase 4, Catalytic Subunit (PPP4C))

Autre désignation: PPP4C (PPP4C Produits)

Synonymes: anticorps pp4, anticorps ppx, anticorps pp4c, anticorps pph3, anticorps MGC75928, anticorps PP4C-A, anticorps gc:56413, anticorps ppp4c, anticorps wu:fd05e08, anticorps zgc:56413, anticorps PP4, anticorps PP4C, anticorps PPH3, anticorps PPP4, anticorps PPX, anticorps 1110002D08Rik, anticorps AU016079, anticorps Ppx, anticorps protein phosphatase 4 catalytic subunit, anticorps protein phosphatase 4, catalytic subunit a, anticorps protein phosphatase 4, catalytic subunit, anticorps protein phosphatase 4 catalytic subunit S homeolog, anticorps ppp4c, anticorps ppp4ca, anticorps PPP4C, anticorps Ppp4c, anticorps ppp4c.S

Sujet: PPP4C is a protein phosphatase that is involved in many processes such as microtubule organization at centrosomes, maturation of spliceosomal snRNPs, apoptosis, tumor necrosis factor (TNF)-alpha signaling, activation of c-Jun N-terminal kinase MAPK8, regulation of histone acetylation, DNA damage checkpoint signaling, NF-kappa-B activation and cell migration.

Poids moléculaire: 34 kDa (MW of target protein)