USP22 anticorps (Middle Region)
-
- Antigène Voir toutes USP22 Anticorps
- USP22 (Ubiquitin Specific Peptidase 22 (USP22))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp USP22 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- USP22 antibody was raised against the middle region of USP22
- Purification
- Affinity purified
- Immunogène
- USP22 antibody was raised using the middle region of USP22 corresponding to a region with amino acids PSSCLVCEMSSLFQEFYSGHRSPHIPYKLLHLVWTHARHLAGYEQQDAHE
- Top Product
- Discover our top product USP22 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
USP22 Blocking Peptide, catalog no. 33R-7372, is also available for use as a blocking control in assays to test for specificity of this USP22 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP22 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- USP22 (Ubiquitin Specific Peptidase 22 (USP22))
- Autre désignation
- USP22 (USP22 Produits)
- Synonymes
- anticorps USP3L, anticorps AI427806, anticorps zgc:136342, anticorps usp22, anticorps usp22 b, anticorps usp22-B, anticorps usp22-a, anticorps usp3l, anticorps ubiquitin specific peptidase 22, anticorps ubiquitin specific peptidase 22 S homeolog, anticorps USP22, anticorps Usp22, anticorps usp22, anticorps usp22.S
- Sujet
- USP22 is a subunit of the SAGA transcriptional cofactor complex. It deubiquitylates histone H2B and is recruited to specific genes by activators like Myc. USP22 is needed for cell cycle progression. It deubiquitylates histone H2A in addition to H2B. Altered mRNA expression is associated with therapy failure and death in patients multiple types of cancer.
- Poids moléculaire
- 60 kDa (MW of target protein)
-