NUP155 anticorps (N-Term)

N° du produit ABIN631629

Détail du produit anti-NUP155 anticorps

Antigène: NUP155 (Nucleoporin 155kDa (NUP155))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NUP155 est non-conjugé

Application: Western Blotting (WB)

Specificité: NUP155 antibody was raised against the N terminal of NUP155

Purification: Affinity purified

Immunogène: NUP155 antibody was raised using the N terminal of NUP155 corresponding to a region with amino acids MPSSLLGAAMPASTSAAALQEALENAGRLIDRQLQEDRMYPDLSELLMVS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NUP155 Blocking Peptide, catalog no. 33R-6308, is also available for use as a blocking control in assays to test for specificity of this NUP155 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP155 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NUP155

Antigène: NUP155 (Nucleoporin 155kDa (NUP155))

Autre désignation: NUP155 (NUP155 Produits)

Sujet: Nucleoporins are the main components of the nuclear pore complex (NPC) of eukaryotic cells. They are involved in the bidirectional trafficking of molecules, especially mRNAs and proteins, between the nucleus and the cytoplasm. NUP155 does not contain the typical FG repeat sequences found in most vertebrate nucleoporins.

Poids moléculaire: 153 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus