NUP50 anticorps (C-Term)

N° du produit ABIN631630

Détail du produit anti-NUP50 anticorps

Antigène: NUP50 (Nucleoporin 50kDa (NUP50))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NUP50 est non-conjugé

Application: Western Blotting (WB)

Specificité: NUP50 antibody was raised against the C terminal of NUP50

Purification: Affinity purified

Immunogène: NUP50 antibody was raised using the C terminal of NUP50 corresponding to a region with amino acids TTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEED

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NUP50 Blocking Peptide, catalog no. 33R-9330, is also available for use as a blocking control in assays to test for specificity of this NUP50 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NUP50

Antigène: NUP50 (Nucleoporin 50kDa (NUP50))

Autre désignation: NUP50 (NUP50 Produits)

Synonymes: anticorps wu:fa56e03, anticorps wu:fb78a08, anticorps GB18194, anticorps npap60, anticorps npap60l, anticorps Nup50, anticorps Rtp60, anticorps 1700030K07Rik, anticorps AI413123, anticorps Npap60, anticorps NPAP60, anticorps NPAP60L, anticorps nucleoporin 50, anticorps nuclear pore complex protein Nup50, anticorps nucleoporin 50kDa S homeolog, anticorps nucleoporin 50kDa, anticorps nup50, anticorps LOC410864, anticorps NUP50, anticorps nup50.S, anticorps CpipJ_CPIJ012737, anticorps Nup50

Sujet: The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. NUP50 is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import.

Poids moléculaire: 50 kDa (MW of target protein)

Pathways: Tube Formation