MBOAT1 anticorps (N-Term)
-
- Antigène Voir toutes MBOAT1 Anticorps
- MBOAT1 (Membrane Bound O-Acyltransferase Domain Containing 1 (MBOAT1))
- Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MBOAT1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MBOAT1 antibody was raised against the N terminal of MBOAT1
- Purification
- Affinity purified
- Immunogène
- MBOAT1 antibody was raised using the N terminal of MBOAT1 corresponding to a region with amino acids AAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFR
- Top Product
- Discover our top product MBOAT1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MBOAT1 Blocking Peptide, catalog no. 33R-1017, is also available for use as a blocking control in assays to test for specificity of this MBOAT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBOAT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MBOAT1 (Membrane Bound O-Acyltransferase Domain Containing 1 (MBOAT1))
- Autre désignation
- MBOAT1 (MBOAT1 Produits)
- Synonymes
- anticorps 1, anticorps LPEAT1, anticorps LPLAT, anticorps LPLAT 1, anticorps LPSAT, anticorps OACT1, anticorps dJ434O11.1, anticorps 9130215M02Rik, anticorps BC023845, anticorps Moact1, anticorps Oact1, anticorps RGD1565521, anticorps RGD1565561, anticorps membrane bound O-acyltransferase domain containing 1, anticorps LOAG_15529, anticorps MBOAT1, anticorps Mboat1
- Sujet
- MBOAT1 shares structural similarity with a superfamily of membrane-bound O-acetyltransferases that transfer organic compounds, usually fatty acids (e.g., cholesterol, diacylglycerol, palmitoyl), onto hydroxyl groups of membrane-embedded targets.
- Poids moléculaire
- 56 kDa (MW of target protein)
-