ANP32B anticorps
-
- Antigène Voir toutes ANP32B Anticorps
- ANP32B (Acidic (Leucine-Rich) Nuclear phosphoprotein 32 Family, Member B (ANP32B))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ANP32B est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ANP32 B antibody was raised using a synthetic peptide corresponding to a region with amino acids GLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLELSENRIFGGLDMLAE
- Top Product
- Discover our top product ANP32B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ANP32B Blocking Peptide, catalog no. 33R-3427, is also available for use as a blocking control in assays to test for specificity of this ANP32B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANP30 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ANP32B (Acidic (Leucine-Rich) Nuclear phosphoprotein 32 Family, Member B (ANP32B))
- Autre désignation
- ANP32B (ANP32B Produits)
- Synonymes
- anticorps APRIL, anticorps PHAPI2, anticorps SSP29, anticorps 2410015B15Rik, anticorps PAL31, anticorps PHAPI2a, anticorps Ssp29, anticorps cb908, anticorps fa99a11, anticorps wu:fa28c10, anticorps wu:fa99a11, anticorps wu:fb40e12, anticorps zgc:77745, anticorps hLAMP-1, anticorps MGC80871, anticorps ANP32B, anticorps MGC69373, anticorps SLAN, anticorps acidic nuclear phosphoprotein 32 family member B, anticorps acidic (leucine-rich) nuclear phosphoprotein 32 family, member B, anticorps acidic nuclear phosphoprotein 32 family member B L homeolog, anticorps acidic leucine-rich nuclear phosphoprotein 32 family member B, anticorps ANP32B, anticorps Anp32b, anticorps anp32b, anticorps anp32b.L, anticorps LOC494442
- Sujet
- ANP32B is a multifunctional protein working as a cell cycle progression factor as well as a cell survival factor. ANP32B is required for the progression from the G1 to the S phase. ANP32B is an anti-apoptotic protein which functions as a caspase-3 inhibitor. It has no phosphatase 2A (PP2A) inhibitor activity.
- Poids moléculaire
- 29 kDa (MW of target protein)
-