SELENBP1 anticorps (C-Term)

N° du produit ABIN631644

Détail du produit anti-SELENBP1 anticorps

Antigène: SELENBP1 (Selenium Binding Protein 1 (SELENBP1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SELENBP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SELENBP1 antibody was raised against the C terminal of SELENBP1

Purification: Affinity purified

Immunogène: SELENBP1 antibody was raised using the C terminal of SELENBP1 corresponding to a region with amino acids KQFYPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SELENBP1 Blocking Peptide, catalog no. 33R-4604, is also available for use as a blocking control in assays to test for specificity of this SELENBP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SELENBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SELENBP1

Antigène: SELENBP1 (Selenium Binding Protein 1 (SELENBP1))

Autre désignation: SELENBP1 (SELENBP1 Produits)

Synonymes: anticorps zgc:65844, anticorps hsbp, anticorps lpsb, anticorps sp56, anticorps sbp56, anticorps MGC82850, anticorps SELENBP1, anticorps LPSB, anticorps SBP56, anticorps SP56, anticorps hSBP, anticorps Lp56, anticorps Lpsb, anticorps Selenbp2, anticorps selenbp1, anticorps SBP, anticorps DL3055C, anticorps FCAALL.79, anticorps selenium-binding protein 1, anticorps selenium binding protein 1, anticorps selenium binding protein 1 S homeolog, anticorps selenium binding protein 1 L homeolog, anticorps selenium-binding protein 1, anticorps selenbp1, anticorps SELENBP1, anticorps selenbp1.S, anticorps Selenbp1, anticorps selenbp1.L, anticorps SBP1

Sujet: SELENBP1 belongs to the selenium-binding protein family. Selenium is an essential nutrient that exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. It has been proposed that the effects of selenium in preventing cancer and neurologic diseases may be mediated by selenium-binding proteins.

Poids moléculaire: 44 kDa (MW of target protein)

Pathways: Brown Fat Cell Differentiation