NKD1 anticorps

N° du produit ABIN631653

Détail du produit anti-NKD1 anticorps

Antigène: NKD1 (Naked Cuticle Homolog 1 (NKD1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NKD1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogène: NKD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELVGDVLRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCPG

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NKD1 Blocking Peptide, catalog no. 33R-2577, is also available for use as a blocking control in assays to test for specificity of this NKD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NKD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NKD1

Antigène: NKD1 (Naked Cuticle Homolog 1 (NKD1))

Autre désignation: NKD1 (NKD1 Produits)

Synonymes: anticorps 2810434J10Rik, anticorps 9030215G15Rik, anticorps Nkd, anticorps Naked1, anticorps naked cuticle homolog 1, anticorps naked cuticle 1 homolog (Drosophila), anticorps naked cuticle homolog 1 (Drosophila), anticorps NKD1, anticorps Nkd1, anticorps nkd1

Sujet: In the mouse, NkDa is a Dishevelled -binding protein that functions as a negative regulator of the Wnt-beta-catenin -Tcf signaling pathway.

Poids moléculaire: 52 kDa (MW of target protein)