UBE2L3 anticorps (C-Term)

N° du produit ABIN631658

Détail du produit anti-UBE2L3 anticorps

Antigène: UBE2L3 (Ubiquitin-Conjugating Enzyme E2L 3 (UBE2L3))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBE2L3 est non-conjugé

Application: Western Blotting (WB)

Specificité: UBE2 L3 antibody was raised against the C terminal of UBE2 3

Purification: Affinity purified

Immunogène: UBE2 L3 antibody was raised using the C terminal of UBE2 3 corresponding to a region with amino acids IQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UBE2L3 Blocking Peptide, catalog no. 33R-4124, is also available for use as a blocking control in assays to test for specificity of this UBE2L3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBE2L3

Antigène: UBE2L3 (Ubiquitin-Conjugating Enzyme E2L 3 (UBE2L3))

Autre désignation: UBE2L3 (UBE2L3 Produits)

Sujet: UBE2L3(ubiquitin-conjugating enzyme E2L 3) Antibody The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s).

Poids moléculaire: 17 kDa (MW of target protein)