UBE2D2 anticorps
-
- Antigène Voir toutes UBE2D2 Anticorps
- UBE2D2 (Ubiquitin-Conjugating Enzyme E2D 2 (UBE2D2))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UBE2D2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- UBE2 D2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFF
- Top Product
- Discover our top product UBE2D2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UBE2D2 Blocking Peptide, catalog no. 33R-1345, is also available for use as a blocking control in assays to test for specificity of this UBE2D2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UBE2D2 (Ubiquitin-Conjugating Enzyme E2D 2 (UBE2D2))
- Autre désignation
- UBE2D2 (UBE2D2 Produits)
- Synonymes
- anticorps E2(17)KB2, anticorps PUBC1, anticorps UBC4, anticorps UBC4/5, anticorps UBCH5B, anticorps 1500034D03Rik, anticorps Ubc2e, anticorps Ube2d2, anticorps ubc4, anticorps ube2d2, anticorps zgc:55886, anticorps E217kB, anticorps ubiquitin conjugating enzyme E2 D2, anticorps ubiquitin-conjugating enzyme E2D 2A, anticorps ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast), anticorps ubiquitin-conjugating enzyme E2D 2, anticorps ubiquitin conjugating enzyme E2 D3, anticorps UBE2D2, anticorps Ube2d2a, anticorps ube2d2, anticorps Ube2d2, anticorps UBE2D3
- Sujet
- The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2D2 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase.
- Poids moléculaire
- 17 kDa (MW of target protein)
- Pathways
- Activation of Innate immune Response, Toll-Like Receptors Cascades
-