G2E3 anticorps (N-Term)

N° du produit ABIN631665

Détail du produit anti-G2E3 anticorps

Antigène: G2E3 (G2/M-Phase Specific E3 Ubiquitin Protein Ligase (G2E3))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp G2E3 est non-conjugé

Application: Western Blotting (WB)

Specificité: KIAA1333 antibody was raised against the N terminal of KIAA1333

Purification: Affinity purified

Immunogène: KIAA1333 antibody was raised using the N terminal of KIAA1333 corresponding to a region with amino acids IWQRGKEEEGVYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKR

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIAA1333 Blocking Peptide, catalog no. 33R-4215, is also available for use as a blocking control in assays to test for specificity of this KIAA1333 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1333 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur G2E3

Antigène: G2E3 (G2/M-Phase Specific E3 Ubiquitin Protein Ligase (G2E3))

Autre désignation: KIAA1333 (G2E3 Produits)

Sujet: KIAA1333 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.

Poids moléculaire: 80 kDa (MW of target protein)