G2E3 anticorps (N-Term)
-
- Antigène Voir toutes G2E3 Anticorps
- G2E3 (G2/M-Phase Specific E3 Ubiquitin Protein Ligase (G2E3))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp G2E3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KIAA1333 antibody was raised against the N terminal of KIAA1333
- Purification
- Affinity purified
- Immunogène
- KIAA1333 antibody was raised using the N terminal of KIAA1333 corresponding to a region with amino acids IWQRGKEEEGVYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKR
- Top Product
- Discover our top product G2E3 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KIAA1333 Blocking Peptide, catalog no. 33R-4215, is also available for use as a blocking control in assays to test for specificity of this KIAA1333 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1333 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- G2E3 (G2/M-Phase Specific E3 Ubiquitin Protein Ligase (G2E3))
- Autre désignation
- KIAA1333 (G2E3 Produits)
- Synonymes
- anticorps KIAA1333, anticorps PHF7B, anticorps sb:cb726, anticorps si:busm1-234g15.1, anticorps si:dz234g15.1, anticorps wu:fe02a06, anticorps wu:fe24c12, anticorps 6030408C04Rik, anticorps 9030416F18, anticorps AW046379, anticorps D930034K21Rik, anticorps mKIAA1333, anticorps RGD1310263, anticorps G2/M-phase specific E3 ubiquitin protein ligase, anticorps G2/M-phase specific E3 ubiquitin ligase, anticorps G2E3, anticorps g2e3, anticorps G2e3
- Sujet
- KIAA1333 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
- Poids moléculaire
- 80 kDa (MW of target protein)
-