PCGF5 anticorps (N-Term)

N° du produit ABIN631667

Détail du produit anti-PCGF5 anticorps

Antigène: PCGF5 (Polycomb Group Ring Finger 5 (PCGF5))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCGF5 est non-conjugé

Application: Western Blotting (WB)

Specificité: PCGF5 antibody was raised against the N terminal of PCGF5

Purification: Affinity purified

Immunogène: PCGF5 antibody was raised using the N terminal of PCGF5 corresponding to a region with amino acids ATQRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCGF5 Blocking Peptide, catalog no. 33R-1571, is also available for use as a blocking control in assays to test for specificity of this PCGF5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCGF5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCGF5

Antigène: PCGF5 (Polycomb Group Ring Finger 5 (PCGF5))

Autre désignation: PCGF5 (PCGF5 Produits)

Synonymes: anticorps RNF159, anticorps 0610009F02Rik, anticorps 1110054A01Rik, anticorps 5830406C17Rik, anticorps 5830443C21Rik, anticorps 9530023M17Rik, anticorps AI324127, anticorps pcgf5, anticorps zgc:136815, anticorps zgc:194668, anticorps zgc:194700, anticorps polycomb group ring finger 5, anticorps polycomb group ring finger 5b, anticorps polycomb group ring finger 5a, anticorps PCGF5, anticorps Pcgf5, anticorps pcgf5b, anticorps pcgf5a

Sujet: PCGF5 contains 1 RING-type zinc finger. It is probable component of some Polycomb group (PcG) multiprotein complex, a complex required to maintain the transcriptionally repressive state of some genes.

Poids moléculaire: 30 kDa (MW of target protein)