PDZK1 anticorps (N-Term)

N° du produit ABIN631670

Détail du produit anti-PDZK1 anticorps

Antigène: PDZK1 (PDZ Domain Containing 1 (PDZK1))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDZK1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PDZK1 antibody was raised against the n terminal of PDZK1

Purification: Affinity purified

Immunogène: PDZK1 antibody was raised using the N terminal of PDZK1 corresponding to a region with amino acids MTSTFNPRECKLSKQEGQNYGFFLRIEKDTEGHLVRVVEKCSPAEKAGLQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDZK1 Blocking Peptide, catalog no. 33R-6566, is also available for use as a blocking control in assays to test for specificity of this PDZK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDZK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDZK1

Antigène: PDZK1 (PDZ Domain Containing 1 (PDZK1))

Autre désignation: PDZK1 (PDZK1 Produits)

Synonymes: anticorps xpdzk1, anticorps PDZK1, anticorps CAP70, anticorps CLAMP, anticorps NHERF-3, anticorps NHERF3, anticorps PDZD1, anticorps 1700023D20Rik, anticorps 2610507N21Rik, anticorps 4921513F16Rik, anticorps AI267131, anticorps AI314638, anticorps AL022680, anticorps D3Ertd537e, anticorps Pdzd1, anticorps mPDZK1, anticorps Clamp, anticorps PDZ domain containing 1, anticorps PDZ domain containing 1 L homeolog, anticorps PDZK1, anticorps pdzk1.L, anticorps pdzk1, anticorps Pdzk1

Sujet: PDZK1 is a scaffold protein that connects plasma membrane proteins and regulatory components, regulating their surface expression in epithelial cells apical domains. It may be involved in the coordination of a diverse range of regulatory processes for ion transport and second messenger cascades. In complex with SLC9A3R1, it may cluster proteins that are functionally dependent in a mutual fashion and modulate the trafficking and the activity of the associated membrane proteins.

Poids moléculaire: 41 kDa (MW of target protein)