Clavesin 1 anticorps (N-Term)
-
- Antigène Voir toutes Clavesin 1 (CLVS1) Anticorps
- Clavesin 1 (CLVS1)
-
Épitope
- N-Term
-
Reactivité
- Rat, Souris, Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Clavesin 1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RLBP1 L1 antibody was raised against the N terminal of RLBP1 1
- Purification
- Affinity purified
- Immunogène
- RLBP1 L1 antibody was raised using the N terminal of RLBP1 1 corresponding to a region with amino acids NFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDIL
- Top Product
- Discover our top product CLVS1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RLBP1L1 Blocking Peptide, catalog no. 33R-6686, is also available for use as a blocking control in assays to test for specificity of this RLBP1L1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RLBP0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Clavesin 1 (CLVS1)
- Autre désignation
- RLBP1L1 (CLVS1 Produits)
- Synonymes
- anticorps RLBP1L1, anticorps rlbp1l1, anticorps CRALBPL, anticorps 4933402J24Rik, anticorps Clvl1, anticorps Rlbp1l1, anticorps Clavesin-1, anticorps RGD1564200, anticorps clavesin 1, anticorps clavesin 1 L homeolog, anticorps CLVS1, anticorps clvs1.L, anticorps Clvs1
- Sujet
- RLBP1L1 contains 1 CRAL-TRIO domain. It may be used as a marker for human hepatocellular carcinomas.
- Poids moléculaire
- 41 kDa (MW of target protein)
-