HAO1 anticorps

N° du produit ABIN631675

Détail du produit anti-HAO1 anticorps

Antigène: HAO1 (Hydroxyacid Oxidase (Glycolate Oxidase) 1 (HAO1))

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HAO1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: HAO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HAO1 Blocking Peptide, catalog no. 33R-3411, is also available for use as a blocking control in assays to test for specificity of this HAO1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HAO1

Antigène: HAO1 (Hydroxyacid Oxidase (Glycolate Oxidase) 1 (HAO1))

Autre désignation: HAO1 (HAO1 Produits)

Synonymes: anticorps hao1, anticorps GOX, anticorps GOX1, anticorps HAOX1, anticorps Gox1, anticorps XDH1, anticorps Hao-1, anticorps hydroxyacid oxidase 1, anticorps hydroxyacid oxidase (glycolate oxidase) 1, anticorps hydroxyacid oxidase (glycolate oxidase) 1 L homeolog, anticorps hydroxyacid oxidase 1, liver, anticorps CpipJ_CPIJ013711, anticorps THEYE_A0075, anticorps hao1, anticorps HAO1, anticorps hao1.L, anticorps Hao1

Sujet: Subcellular location of HAO1 is the peroxisome. Specifically, HAO1 is expressed primarily in liver and pancreas and is most active on glycolate, a two-carbon substrate. The protein is also active on 2-hydroxy fatty acids.

Poids moléculaire: 41 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process