PES1 anticorps
-
- Antigène Voir toutes PES1 Anticorps
- PES1 (Pescadillo Ribosomal Biogenesis Factor 1 (PES1))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PES1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PES1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKREKYLYQKIMFGKRRKIREANKLAEKRKAHDEAVRSEKKAKKARPE
- Top Product
- Discover our top product PES1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PES1 Blocking Peptide, catalog no. 33R-4489, is also available for use as a blocking control in assays to test for specificity of this PES1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PES1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PES1 (Pescadillo Ribosomal Biogenesis Factor 1 (PES1))
- Autre désignation
- PES1 (PES1 Produits)
- Synonymes
- anticorps PES, anticorps pes, anticorps pes1, anticorps pescadillo ribosomal biogenesis factor 1, anticorps pescadillo ribosomal biogenesis factor 1 S homeolog, anticorps Pescadillo, anticorps PES1, anticorps Pes1, anticorps pes1.S, anticorps pesc
- Sujet
- PES1 is abnormally elevated in malignant tumors of astrocytic origin. It is a strongly conserved gene containing a BRCT domain that is essential for the activity of this gene product. The gene plays a crucial role in cell proliferation and may be necessary for oncogenic transformation and tumor progression.
- Poids moléculaire
- 68 kDa (MW of target protein)
-