ERI2 anticorps (Middle Region)
-
- Antigène Tous les produits ERI2 (EXOD1)
- ERI2 (EXOD1) (ERI1 Exoribonuclease Family Member 2 (EXOD1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ERI2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ERI2 antibody was raised against the middle region of ERI2
- Purification
- Affinity purified
- Immunogène
- ERI2 antibody was raised using the middle region of ERI2 corresponding to a region with amino acids LQEVGIEFSGREHSGLDDSRNTALLAWKMIRDGCVMKITRSLNKGPFLLP
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ERI2 Blocking Peptide, catalog no. 33R-5308, is also available for use as a blocking control in assays to test for specificity of this ERI2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERI2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ERI2 (EXOD1) (ERI1 Exoribonuclease Family Member 2 (EXOD1))
- Autre désignation
- ERI2 (EXOD1 Produits)
- Synonymes
- anticorps exod1, anticorps EXOD1, anticorps Exod1, anticorps 4933424N09Rik, anticorps mKIAA1504, anticorps eri2, anticorps ERI1 exoribonuclease family member 2 L homeolog, anticorps ERI1 exoribonuclease family member 2, anticorps exoribonuclease 2, anticorps eri2.L, anticorps ERI2, anticorps Eri2, anticorps eri2
- Sujet
- EXOD1 belongs to the EXOD1 family. It contains 1 exonuclease domain. EXOD1 is a member of a new subclass of exonucleases called the 3'hExo/ERI-1 subfamily of DEDDh nucleases.
- Poids moléculaire
- 37 kDa (MW of target protein)
-