NT5DC1 anticorps (N-Term)

N° du produit ABIN631687

Détail du produit anti-NT5DC1 anticorps

Antigène: NT5DC1 (5'-Nucleotidase Domain Containing 1 (NT5DC1))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NT5DC1 est non-conjugé

Application: Western Blotting (WB)

Specificité: NT5 DC1 antibody was raised against the N terminal of NT5 C1

Purification: Affinity purified

Immunogène: NT5 DC1 antibody was raised using the N terminal of NT5 C1 corresponding to a region with amino acids EWKHFLSDTGMACRSGKYYFYDNYFDLPGALLCARVVDYLTKLNNGQKTF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NT5DC1 Blocking Peptide, catalog no. 33R-2811, is also available for use as a blocking control in assays to test for specificity of this NT5DC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NT0 C1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NT5DC1

Antigène: NT5DC1 (5'-Nucleotidase Domain Containing 1 (NT5DC1))

Autre désignation: NT5DC1 (NT5DC1 Produits)

Synonymes: anticorps C6orf200, anticorps LP2642, anticorps NT5C2L1, anticorps 6030401B09Rik, anticorps AW987726, anticorps Nt5c2l1, anticorps fj64b02, anticorps si:dkey-121j17.1, anticorps wu:fj64b02, anticorps Nt5dc1, anticorps cb904, anticorps id:ibd5113, anticorps nt5c2, anticorps zgc:92102, anticorps 5'-nucleotidase domain containing 1, anticorps 5'-nucleotidase domain-containing protein 1, anticorps 5'-nucleotidase, cytosolic II, like 1, anticorps NT5DC1, anticorps nt5dc1.L, anticorps Nt5dc1, anticorps nt5dc1, anticorps LOC100714559, anticorps nt5c2l1

Sujet: While the exact function of the protein encoded by this gene is not known, it belongs to the 5'(3')-deoxyribonucleotidase family.

Poids moléculaire: 52 kDa (MW of target protein)