NEDD1 anticorps (N-Term)
-
- Antigène Voir toutes NEDD1 Anticorps
- NEDD1 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 1 (NEDD1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NEDD1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NEDD1 antibody was raised against the N terminal of NEDD1
- Purification
- Affinity purified
- Immunogène
- NEDD1 antibody was raised using the N terminal of NEDD1 corresponding to a region with amino acids MQENLRFASSGDDIKIWDASSMTLVDKFNPHTSPHGISSICWSSNNNFLV
- Top Product
- Discover our top product NEDD1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NEDD1 Blocking Peptide, catalog no. 33R-6323, is also available for use as a blocking control in assays to test for specificity of this NEDD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEDD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NEDD1 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 1 (NEDD1))
- Autre désignation
- NEDD1 (NEDD1 Produits)
- Synonymes
- anticorps MGC81767, anticorps MGC145237, anticorps GCP-WD, anticorps TUBGCP7, anticorps neural precursor cell expressed, developmentally down-regulated 1 L homeolog, anticorps neural precursor cell expressed, developmentally down-regulated 1, anticorps cilia and flagella associated protein 54, anticorps neural precursor cell expressed, developmentally down-regulated gene 1, anticorps nedd1.L, anticorps nedd1, anticorps CFAP54, anticorps NEDD1, anticorps Nedd1
- Sujet
- NEDD1 is required for mitosis progression. NEDD1 promotes the nucleation of microtubules from the spindle.
- Poids moléculaire
- 72 kDa (MW of target protein)
- Pathways
- M Phase
-