WDR35 anticorps (N-Term)

N° du produit ABIN631708

Détail du produit anti-WDR35 anticorps

Antigène: WDR35 (WD Repeat Domain 35 (WDR35))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WDR35 est non-conjugé

Application: Western Blotting (WB)

Specificité: WDR35 antibody was raised against the N terminal of WDR35

Purification: Affinity purified

Immunogène: WDR35 antibody was raised using the N terminal of WDR35 corresponding to a region with amino acids SGSVQVVTWNEQYQKLTTSDENGLIIVWMLYKGSWIEEMINNRNKSVVRS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WDR35 Blocking Peptide, catalog no. 33R-8495, is also available for use as a blocking control in assays to test for specificity of this WDR35 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR35 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WDR35

Antigène: WDR35 (WD Repeat Domain 35 (WDR35))

Autre désignation: WDR35 (WDR35 Produits)

Synonymes: anticorps 4930459M12Rik, anticorps 4931430C06, anticorps mKIAA1336, anticorps RGD1564116, anticorps Wdr35, anticorps CED2, anticorps IFT121, anticorps im:7159945, anticorps si:ch211-206k20.4, anticorps WD repeat domain 35, anticorps Wdr35, anticorps WDR35, anticorps wdr35

Sujet: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the biological validity of some variants has not been determined.

Poids moléculaire: 132 kDa (MW of target protein)

Pathways: Signalisation Hedgehog