TPRN anticorps (Middle Region)

N° du produit ABIN631720

Détail du produit anti-TPRN anticorps

Antigène: TPRN (Taperin (TPRN))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TPRN est non-conjugé

Application: Western Blotting (WB)

Specificité: C9 ORF75 antibody was raised against the middle region of C9 rf75

Purification: Affinity purified

Immunogène: C9 ORF75 antibody was raised using the middle region of C9 rf75 corresponding to a region with amino acids EAMVRCGGVERWGESDTRASPCVHILSSHFQLTPASQNDLSDFRSEPALY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C9ORF75 Blocking Peptide, catalog no. 33R-2269, is also available for use as a blocking control in assays to test for specificity of this C9ORF75 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF75 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TPRN

Antigène: TPRN (Taperin (TPRN))

Autre désignation: C9ORF75 (TPRN Produits)

Synonymes: anticorps C9orf75, anticorps DFNB79, anticorps RP11-350O14.7, anticorps C430004E15Rik, anticorps C87750, anticorps RP23-132N23.15, anticorps taperin, anticorps TPRN, anticorps Tprn

Sujet: The specific function of C9orf75 is not yet known.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: Sensory Perception of Sound